PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10033388m
Common NameCICLE_v10033388mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 340aa    MW: 39099 Da    PI: 8.1607
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10033388mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.44.9e-31175229155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r+rWt+ LH+rFve+ve LGG+ekAtPk il+lm+++gLt+ hvkSHLQkYR+
  Ciclev10033388m 175 KTRIRWTQHLHNRFVECVEFLGGAEKATPKGILKLMDIDGLTIFHVKSHLQKYRT 229
                      68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.2E-17173229IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-27173230IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-23175229IPR006447Myb domain, plants
PfamPF002491.0E-5179228IPR001005SANT/Myb domain
PfamPF143795.6E-18262308IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MKTEKRKVLE QRYSYRSSQE QLPCKVGLSF HSQLPNVEGE GSFKLNPGSC NASGFICSSN  60
FAMPNSVFYA AENCMDFSQD LDNFDLQSSV KVHLQYNQNP SLPKKQPHQD AYRNSPASVF  120
SFMQDPAEEE ASLNERQKCV SFSEYQKHQI LKPSSYHVQT HHEKQAPNTM TSHSKTRIRW  180
TQHLHNRFVE CVEFLGGAEK ATPKGILKLM DIDGLTIFHV KSHLQKYRTA RHIPEGKSKR  240
ERTTDLNAIV RLDSESFINR GMQLVETLKL QLDVQKRLHD QLEVQRNLQL QIEEQGKQLT  300
QMLDQQLKPN KSLVDSNNVD IELQDNQPND LKDTRPFNI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006439038.10.0hypothetical protein CICLE_v10033388mg
TrEMBLV4SWJ90.0V4SWJ9_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54762748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-53G2-like family protein